Mameliella alba: KU6B_53750 Help Entry KU6B_53750        CDS       T06509                                  Name (GenBank) hypothetical protein   KO K00058   D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399] Organism malu  Mameliella alba Pathway malu00260   Glycine, serine and threonine metabolism malu00270   Cysteine and methionine metabolism malu00680   Methane metabolism malu01100   Metabolic pathways malu01110   Biosynthesis of secondary metabolites malu01120   Microbial metabolism in diverse environments malu01200   Carbon metabolism malu01230   Biosynthesis of amino acids Module malu_M00020   Serine biosynthesis, glycerate-3P => serine Brite KEGG Orthology (KO) [BR:malu00001]  09100 Metabolism   09102 Energy metabolism    00680 Methane metabolism     KU6B_53750   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     KU6B_53750    00270 Cysteine and methionine metabolism     KU6B_53750  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malu04147]     KU6B_53750 Enzymes [BR:malu01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.95  phosphoglycerate dehydrogenase      KU6B_53750     1.1.1.399  2-oxoglutarate reductase      KU6B_53750 Exosome [BR:malu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    KU6B_53750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  2-Hacid_dh_C Motif Other DBs NCBI-ProteinID:  BBU59110 UniProt:  A0A6F8QEX2 LinkDB All DBs Position complement(5237322..5237786) Genome browser AA seq 154 aa AA seqDB search MVGVGRGARPRPGRWRGTGPDRARFFADSDFVSLHVRLKPATRGIITAEDLLGMKPSASF INTSRSGLVAPGALDKALEAGRPGRLALDVFDTEPLTDAKDPLVNHPSVIATPHIGYVTE DELDMQFADIYDQINAYAEGAPIHMINPEARGGQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt gtggtgggggtcggacgaggggcgcgcccgcgcccgggccgatggcgcggaactggcccc gaccgcgcccgctttttcgccgacagcgattttgtcagcctgcatgtccgcctgaaaccg gcgacgcgcgggatcatcaccgccgaggacctgctgggcatgaagccctcggccagcttc atcaacacctcgcggtctggccttgtcgcgccgggtgcgctggacaaggcactggaggcg gggcgccccgggcggctggcgctggatgtctttgacacggaaccgctgaccgatgccaag gatccgctggtcaatcacccttcggtcatcgcgacgccgcatatcggctacgtcaccgag gatgagctggatatgcagttcgccgacatctacgaccagatcaacgcctatgccgagggc gcgccgatccacatgatcaaccccgaggcccggggcggccagtga

DBGET integrated database retrieval system