Mycolicibacterium alvei: MALV_19380
Help
Entry
MALV_19380 CDS
T06961
Symbol
mtrA
Name
(GenBank) DNA-binding response regulator MtrA
KO
K07670
two-component system, OmpR family, response regulator MtrA
Organism
malv
Mycolicibacterium alvei
Pathway
malv02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
malv00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
MALV_19380 (mtrA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
malv02022
]
MALV_19380 (mtrA)
Two-component system [BR:
malv02022
]
OmpR family
MtrB-MtrA (osmotic stress response)
MALV_19380 (mtrA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
GlnR_1st
B12-binding
Motif
Other DBs
NCBI-ProteinID:
BBX26813
UniProt:
A0A6N4USH0
LinkDB
All DBs
Position
complement(2003075..2003761)
Genome browser
AA seq
228 aa
AA seq
DB search
MDTMRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLP
GMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYVMKPFKPKELVARVRARL
RRNEDEPAELLSINDVEIDVPAHKVTRQGEQISLTPLEFDLLVALARKPRQVFTRDVLLE
QVWGYRHPADTRLVNVHVQRLRAKVEKDPENPQVVLTVRGVGYKAGPP
NT seq
687 nt
NT seq
+upstream
nt +downstream
nt
atggacaccatgaggcaaaggatccttgtcgtcgacgacgacccgtcactggccgagatg
ctcaccatcgtcttgcgtggtgagggattcgacaccgcggtcatcggcgacggcacccaa
gcactgaccgcggtccgcgaattgcggcccgacctggtgctgttggacctgatgttgccc
ggcatgaacgggatcgacgtgtgccgggtgctccgtgccgactccggtgtcccgatcgtc
atgctgacggccaagaccgacaccgtcgacgtggtgctgggtctggaatccggcgccgac
gactatgtgatgaagccgttcaagcccaaggagctggtggcccgggtgcgcgcccggctg
cggcgcaacgaggacgagccggccgagctgctgtcgatcaacgatgtcgagatcgacgtg
ccggcccacaaggtgacccgtcagggcgagcagatttcgctgacgccgctggagttcgac
ctgctcgtggcgctggcacgcaaaccacgccaggtgtttactcgtgatgtgctgctcgaa
caggtgtggggatatcggcaccccgctgacacccgtttggtgaacgtgcatgtccagcgg
ttgcgggccaaggttgagaaagacccggagaacccgcaggtggtgttgacagttcgagga
gtgggatacaaggccggacccccgtga
DBGET
integrated database retrieval system