Mycteria americana (wood stork): 142406612 Help Entry 142406612         CDS       T11228                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism mame  Mycteria americana (wood stork) Pathway mame04080   Neuroactive ligand-receptor interaction mame04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:mame00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     142406612 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     142406612 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mame04052]     142406612 (NPY) Cytokines and neuropeptides [BR:mame04052]  Neuropeptides   GPCR binding    142406612 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 LURY1 Motif Other DBs NCBI-GeneID:  142406612 NCBI-ProteinID:  XP_075351675 LinkDB All DBs Position 2:36746937..36756299 Genome browser AA seq 97 aa AA seqDB search MQGTVRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPAEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLLRESTENIPRSRFEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagggtaccgtgaggctgtgggtgtcggtgctgactttcgccctgtcgctgctggtc tgcctggggacgctggcagaggcgtacccctccaaaccggacagccccgccgaggacgcc cccgcagaggacatggccagatactactcggcgctgaggcactacatcaacctcatcacc aggcagagatacggaaagagatcaagcccagagacactgatctcagacctcttgttgagg gaaagcacagaaaatattcctagatccaggtttgaagacccttcgatgtggtga

DBGET integrated database retrieval system