Mycteria americana (wood stork): 142408420 Help Entry 142408420         CDS       T11228                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mame  Mycteria americana (wood stork) Pathway mame04814   Motor proteins mame05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mame00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     142408420 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142408420 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mame03037]     142408420 (DYNLT1)    04812 Cytoskeleton proteins [BR:mame04812]     142408420 (DYNLT1) Cilium and associated proteins [BR:mame03037]  Motile cilia and associated proteins   Dynein arm    142408420 (DYNLT1) Cytoskeleton proteins [BR:mame04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      142408420 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  142408420 NCBI-ProteinID:  XP_075355039 LinkDB All DBs Position 3:68935482..68941724 Genome browser AA seq 113 aa AA seqDB search MDDFQSGEETSFVVDEVSSIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccagtcgggggaggagacttcctttgttgttgatgaagtcagtagcatc attaaagaggccatagaaagtgcgataggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaacgctaagccaactcacaaagctggggaagcct ttcaagtatattgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag actatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system