Mycteria americana (wood stork): 142413350
Help
Entry
142413350 CDS
T11228
Symbol
SKP1
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
mame Mycteria americana (wood stork)
Pathway
mame03083
Polycomb repressive complex
mame04110
Cell cycle
mame04114
Oocyte meiosis
mame04120
Ubiquitin mediated proteolysis
mame04141
Protein processing in endoplasmic reticulum
mame04310
Wnt signaling pathway
mame04350
TGF-beta signaling pathway
mame05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
mame00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
142413350 (SKP1)
04120 Ubiquitin mediated proteolysis
142413350 (SKP1)
09126 Chromosome
03083 Polycomb repressive complex
142413350 (SKP1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
142413350 (SKP1)
04350 TGF-beta signaling pathway
142413350 (SKP1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
142413350 (SKP1)
04114 Oocyte meiosis
142413350 (SKP1)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
142413350 (SKP1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
mame04131
]
142413350 (SKP1)
04121 Ubiquitin system [BR:
mame04121
]
142413350 (SKP1)
03036 Chromosome and associated proteins [BR:
mame03036
]
142413350 (SKP1)
Membrane trafficking [BR:
mame04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
142413350 (SKP1)
Ubiquitin system [BR:
mame04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
142413350 (SKP1)
Cul7 complex
142413350 (SKP1)
Chromosome and associated proteins [BR:
mame03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
142413350 (SKP1)
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
142413350 (SKP1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
142413350
NCBI-ProteinID:
XP_075365511
LinkDB
All DBs
Position
8:complement(4033630..4043591)
Genome browser
AA seq
163 aa
AA seq
DB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaaactgcagagttcagatggagaaatctttgaagttgatgttgaaatt
gcaaaacagtctgtaactataaagactatgctggaagatttgggaatggatgatgaaggt
gacgatgacccagtgcctcttccaaatgttaatgcagctatcttaaaaaaggtgattcag
tggtgcacccatcacaaggatgatccaccacctcctgaggatgatgagaacaaagaaaaa
agaacagatgacatccctgtgtgggatcaagagtttctgaaagtagaccaaggaacgctt
tttgaacttatcctggctgcaaattacttggacatcaaaggtttgcttgatgtcacatgc
aagacagttgcaaacatgatcaaggggaaaactccagaagaaattcgcaagacattcaat
attaagaatgacttcactgaggaggaagaagcacaggtacgtaaagagaaccagtggtgt
gaagagaagtga
DBGET
integrated database retrieval system