Mycteria americana (wood stork): 142413422 Help Entry 142413422         CDS       T11228                                  Name (RefSeq) C-C motif chemokine 5-like   KO K21083   C-C motif chemokine 17 Organism mame  Mycteria americana (wood stork) Pathway mame04060   Cytokine-cytokine receptor interaction mame04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mame00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     142413422  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     142413422  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mame04052]     142413422 Cytokines and neuropeptides [BR:mame04052]  Cytokines   Chemokines    142413422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  142413422 NCBI-ProteinID:  XP_075365664 LinkDB All DBs Position 8:26901093..26902150 Genome browser AA seq 94 aa AA seqDB search MFSTRTVLVLAMLLTLSPHCDAAPYTPSECCFSYVKSPLRLANLKGFYTTPKECFSPAIV FETSNGTKLCAKPDMIWVEKAVEGLQKRKGLHAP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttcagtacaaggacggtcctggtgctcgcgatgctcctcaccctctccccacactgt gatgcagccccttacacaccgtctgagtgctgcttcagttacgtaaagtcccctctccgg ctggctaacctgaagggtttctacacaactcccaaggagtgtttttccccagcaattgtg tttgagaccagcaacgggaccaagctctgtgcaaaaccagacatgatttgggtggagaaa gcagttgaggggcttcaaaaaaggaaaggactccatgccccctga

DBGET integrated database retrieval system