Mycteria americana (wood stork): 142415486 Help Entry 142415486         CDS       T11228                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mame  Mycteria americana (wood stork) Pathway mame04137   Mitophagy - animal mame04140   Autophagy - animal mame04144   Endocytosis mame04145   Phagosome mame04148   Efferocytosis mame05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mame00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     142415486 (RAB7A)    04145 Phagosome     142415486 (RAB7A)    04140 Autophagy - animal     142415486 (RAB7A)    04137 Mitophagy - animal     142415486 (RAB7A)    04148 Efferocytosis     142415486 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142415486 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mame04131]     142415486 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mame04147]     142415486 (RAB7A)    04031 GTP-binding proteins [BR:mame04031]     142415486 (RAB7A) Membrane trafficking [BR:mame04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     142415486 (RAB7A) Exosome [BR:mame04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    142415486 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    142415486 (RAB7A)   Exosomal proteins of colorectal cancer cells    142415486 (RAB7A)   Exosomal proteins of bladder cancer cells    142415486 (RAB7A) GTP-binding proteins [BR:mame04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     142415486 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  142415486 NCBI-ProteinID:  XP_075369990 LinkDB All DBs Position 11:23655326..23675680 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacgatttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtatttgatgtcacggcccccaacacattcaaaaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaatttcctgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system