Mycteria americana (wood stork): 142421523 Help Entry 142421523         CDS       T11228                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mame  Mycteria americana (wood stork) Pathway mame04621   NOD-like receptor signaling pathway mame05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mame00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     142421523  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142421523  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mame03110]     142421523 Chaperones and folding catalysts [BR:mame03110]  Protein folding catalysts   Protein disulfide isomerase    142421523 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 AhpC-TSA Thioredoxin_8 DIM1 Glutaredoxin OST3_OST6 Thioredoxin_9 Thioredoxin_7 PedC-like Redoxin Motif Other DBs NCBI-GeneID:  142421523 NCBI-ProteinID:  XP_075382280 LinkDB All DBs Position Z:68749725..68758650 Genome browser AA seq 105 aa AA seqDB search MVKSVGSLPEFEAELKSAGDKLVVVDFSATWCGPCKMIKPFFHSLCEKYGDVMFIEVDVD DAQDVAAHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagagtgtgggcagcctgcctgaatttgaggcagaactgaaatctgctggtgac aagcttgtagtagttgatttctctgctacatggtgtggaccatgcaaaatgatcaagccc tttttccacagtttgtgtgagaagtatggcgatgtgatgttcatcgaagttgatgtggat gatgcccaggatgttgctgcacactgcgatgtgaagtgcatgccaacgttccagttctac aagaacggaaagaaggtacaggagttctctggggccaataaagagaagcttgaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system