Mycteria americana (wood stork): 142421654 Help Entry 142421654         CDS       T11228                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism mame  Mycteria americana (wood stork) Pathway mame04068   FoxO signaling pathway mame04136   Autophagy - other mame04140   Autophagy - animal mame04621   NOD-like receptor signaling pathway mame04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:mame00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     142421654 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     142421654 (ATG12)    04136 Autophagy - other     142421654 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     142421654 (ATG12)    04622 RIG-I-like receptor signaling pathway     142421654 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mame04131]     142421654 (ATG12)    04121 Ubiquitin system [BR:mame04121]     142421654 (ATG12)    03029 Mitochondrial biogenesis [BR:mame03029]     142421654 (ATG12) Membrane trafficking [BR:mame04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     142421654 (ATG12) Ubiquitin system [BR:mame04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    142421654 (ATG12) Mitochondrial biogenesis [BR:mame03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     142421654 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  142421654 NCBI-ProteinID:  XP_075382660 LinkDB All DBs Position Z:62752760..62755646 Genome browser AA seq 142 aa AA seqDB search MAEAEEQSPVSPQSEGRSEGGEEAPEGGAAAAAADPAPPPAGSPGTEEPAGDTKKKIDIL LKAVGDTPIMKTKKWAVERTRTIQGLVDFIKKFLKLMASEQLFIYVNQSFAPSPDQEVGT LYECFGSDGKLVLHYCKTQAWG NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggcggaagcggaggagcagtcgccggtctcgcctcagagcgagggccgaagcgagggc ggggaggaagccccggaaggcggagcggcagcggcggctgccgacccggcccctcctccg gccggctcgccgggcaccgaggagcctgccggcgacacgaaaaagaaaattgacatcctg ctgaaggccgtgggcgacacccccatcatgaagaccaagaagtgggccgtggagcggacc cgcaccatccagggcctcgttgacttcatcaagaagttcctcaagctgatggcctccgag cagctgttcatatatgtaaaccagtcttttgctccatctccagaccaagaagttgggacc ctttatgagtgttttggaagtgatggcaagcttgtactgcattattgcaaaactcaggca tggggatga

DBGET integrated database retrieval system