Marinobacter sp. MMG032: ABNF92_16700 Help Entry ABNF92_16700      CDS       T10637                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mamm  Marinobacter sp. MMG032 Pathway mamm02024   Quorum sensing mamm03018   RNA degradation Brite KEGG Orthology (KO) [BR:mamm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ABNF92_16700 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ABNF92_16700 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mamm03019]     ABNF92_16700 (hfq)    03036 Chromosome and associated proteins [BR:mamm03036]     ABNF92_16700 (hfq) Messenger RNA biogenesis [BR:mamm03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ABNF92_16700 (hfq) Chromosome and associated proteins [BR:mamm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ABNF92_16700 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  XBQ19072 UniProt:  A0AAU7MNN1 LinkDB All DBs Position 3627734..3627985 Genome browser AA seq 83 aa AA seqDB search MSKGHSLQDPYLNALRKERIPVSIFLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARNVRIPQQAPGGEGESED NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgttacaagacccttaccttaatgcactgcgcaaggaacgcatt ccggtttccatctttctggtcaacggtatcaagctacagggccagatcgaatctttcgac cagttcgtgattttgctgaaaaatactgtcagccagatggtctacaagcacgctatttcc actgtggtacctgcacgtaatgttcgcattccgcagcaggctccgggaggagagggcgag tctgaggactga

DBGET integrated database retrieval system