Marinobacter sp. MMG032: ABNF92_17490 Help Entry ABNF92_17490      CDS       T10637                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism mamm  Marinobacter sp. MMG032 Brite KEGG Orthology (KO) [BR:mamm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mamm03110]     ABNF92_17490 (groES)    03029 Mitochondrial biogenesis [BR:mamm03029]     ABNF92_17490 (groES) Chaperones and folding catalysts [BR:mamm03110]  Heat shock proteins   HSP10    ABNF92_17490 (groES) Mitochondrial biogenesis [BR:mamm03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ABNF92_17490 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 RNase_J_b_CASP Motif Other DBs NCBI-ProteinID:  XBQ19221 LinkDB All DBs Position 3807878..3808165 Genome browser AA seq 95 aa AA seqDB search MKIRPLHDRVVVRRKEEEEKTAGGIVLPGNAKEKPSQGEVIAVGNGRILENGETRSLAVK VGDTVVFGQYAGNTVKIDGEELLIMSESDIYGVLE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccgctacacgatcgtgttgtcgtgcgccgtaaggaagaagaagagaaa actgcgggtggcatcgtgctgccgggtaacgccaaagagaagccttcccagggtgaggtg attgccgttggtaacggtcgcattctggaaaacggcgaaacccgctcactggcggtcaag gtgggtgacaccgtggtcttcggccagtacgccggtaacaccgtcaagatcgacggcgaa gagctcctcatcatgagcgagagcgatatttacggcgtgcttgagtga

DBGET integrated database retrieval system