Mesorhizobium amorphae: A6B35_13290 Help Entry A6B35_13290       CDS       T04446                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mamo  Mesorhizobium amorphae Pathway mamo01100   Metabolic pathways mamo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mamo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6B35_13290    00074 Mycolic acid biosynthesis     A6B35_13290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6B35_13290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ANT50820 UniProt:  G6YDN4 LinkDB All DBs Position 2874086..2874322 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDADKVTEQASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKYIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacaccgcagagcgcgtcaagaagatcgtcatcgagcatcttggcgtcgacgcc gacaaggtgacggagcaggcgagcttcatcgacgatctgggcgctgacagcctcgacacg gtcgaactcgtcatggcgttcgaagaagaattcggcgtcgagatcccggacgatgcggcc gagaccatcctgaccgtcggcgatgccgtgaagtacatcgacaaggcctcggcctga

DBGET integrated database retrieval system