Micavibrio aeruginosavorus EPB: A11S_1579 Help Entry A11S_1579         CDS       T02517                                  Name (GenBank) Glutaredoxin, GrxC   KO K03676   glutaredoxin 3 Organism man  Micavibrio aeruginosavorus EPB Brite KEGG Orthology (KO) [BR:man00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:man03110]     A11S_1579 Chaperones and folding catalysts [BR:man03110]  Protein folding catalysts   Protein disulfide isomerase    A11S_1579 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like CLIC-like_N SH3BGR Thioredoxin_3 Thioredoxin_2 Zn_ribbon_tTFIIB GST_N Motif Other DBs NCBI-ProteinID:  AGH98383 UniProt:  M4VGP2 LinkDB All DBs Position complement(1627913..1628170) Genome browser AA seq 85 aa AA seqDB search MAKVEIYSGAYCPYCDRAKALLTRKGVSFTEYKVDEDDAKREEMLGRANGRRTIPQIFIN DAHIGGCDDLHALDSKGELDQLLSA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtcgagatttactccggggcgtattgcccgtattgcgaccgggcaaaagcc ctgctgacccgcaagggcgtgtccttcaccgaatacaaagtggatgaggacgatgcaaag cgcgaagaaatgctgggccgggccaatggccgccgcaccattccgcagattttcatcaac gatgcgcatattggcgggtgtgatgatctgcatgcgctggattcgaaaggggagctggac cagctcctgtccgcatga

DBGET integrated database retrieval system