Micavibrio aeruginosavorus EPB: A11S_2262 Help Entry A11S_2262         CDS       T02517                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism man  Micavibrio aeruginosavorus EPB Pathway man01100   Metabolic pathways man01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:man00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A11S_2262    00074 Mycolic acid biosynthesis     A11S_2262   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A11S_2262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AGH99058 UniProt:  M4VIP1 LinkDB All DBs Position 2301841..2302080 Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVIDHLGVDEAKVVEAASFIDDLGADSLDTVELVMAFEEEFSVEIPDDAA EKIQTVGDAISFIKENSAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattgctgagcgcgtgaagaaaattgtaatcgatcatttgggcgtcgacgaa gccaaagtggttgaagcagcgagcttcattgacgatctgggcgcagactccctcgacact gttgagctggtcatggccttcgaagaagaattcagcgtcgaaatcccggacgatgccgct gagaaaattcagacggttggtgacgcgatcagcttcatcaaggaaaactccgctgcctaa

DBGET integrated database retrieval system