Micavibrio aeruginosavorus EPB: A11S_949 Help Entry A11S_949          CDS       T02517                                  Name (GenBank) Ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism man  Micavibrio aeruginosavorus EPB Pathway man00030   Pentose phosphate pathway man00051   Fructose and mannose metabolism man00710   Carbon fixation by Calvin cycle man01100   Metabolic pathways man01110   Biosynthesis of secondary metabolites man01120   Microbial metabolism in diverse environments man01200   Carbon metabolism man01230   Biosynthesis of amino acids Module man_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:man00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     A11S_949    00051 Fructose and mannose metabolism     A11S_949   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     A11S_949 Enzymes [BR:man01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      A11S_949 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AGH97770 UniProt:  M4VH03 LinkDB All DBs Position 986374..986814 Genome browser AA seq 146 aa AA seqDB search MPDRQTLAIACDHAGFALKETLKSHFADRIDWVDLGTDSTESVSYADFGKKMGQAITDGR VQRGIVICGSGIGISIAANRFPAVRAALCTDATMARLARQHNDANVLALGGRIIGLQVAI DCVDAFLNTAFEGGRHAARVDALGQC NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcccgaccgtcagaccctggctattgcctgcgatcacgcgggctttgcgttgaaggaa accctgaaatcccattttgccgaccggatcgattgggtcgatctggggacggacagtacc gagtcggtcagctatgccgattttggtaaaaaaatggggcaggccatcacggatggccgg gttcagcgcggcattgtgatttgtgggtccgggatcggtatttcgattgcggccaatcgt ttcccggcggtgcgggccgctttgtgcaccgatgcaaccatggcccgccttgcccgccaa cataatgatgccaacgttctggccttgggtgggcggatcattgggcttcaggtcgcgatt gattgcgtcgacgcgtttttaaataccgcattcgaaggcggccgccatgcggcccgtgtc gatgcgttggggcaatgttaa

DBGET integrated database retrieval system