Mangrovimonas sp. YM274: RBH95_07005 Help Entry RBH95_07005       CDS       T09317                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mang  Mangrovimonas sp. YM274 Brite KEGG Orthology (KO) [BR:mang00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mang03032]     RBH95_07005    03036 Chromosome and associated proteins [BR:mang03036]     RBH95_07005    03400 DNA repair and recombination proteins [BR:mang03400]     RBH95_07005 DNA replication proteins [BR:mang03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RBH95_07005 Chromosome and associated proteins [BR:mang03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RBH95_07005 DNA repair and recombination proteins [BR:mang03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RBH95_07005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  WMI70090 LinkDB All DBs Position complement(1602736..1603008) Genome browser AA seq 90 aa AA seqDB search MNKTDLINGMAENAGISKAAAKKALDSLLIDIEGALQKGNRVSLVGFGTWSVSKRSAREG RNPQTGKTIQIKAKNVVKFKAGSDLSSAIN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatttaatcaatggaatggcagaaaacgctggaatttctaaagctgcg gccaaaaaagcattagattcattattaattgacatcgaaggagctttacaaaaaggaaat agagtttctttggtaggatttggaacttggtctgtatctaaaagatctgcaagagaggga agaaatccacaaactggtaaaactatccaaattaaagctaaaaacgtagttaagtttaaa gcaggatctgatttatcaagcgctattaactaa

DBGET integrated database retrieval system