Mannheimia pernigra ZY170218: GM695_00805 Help Entry GM695_00805       CDS       T06423                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mann  Mannheimia pernigra ZY170218 Pathway mann02024   Quorum sensing mann03018   RNA degradation Brite KEGG Orthology (KO) [BR:mann00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GM695_00805 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GM695_00805 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mann03019]     GM695_00805 (hfq)    03036 Chromosome and associated proteins [BR:mann03036]     GM695_00805 (hfq) Messenger RNA biogenesis [BR:mann03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GM695_00805 (hfq) Chromosome and associated proteins [BR:mann03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GM695_00805 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Gag_p24_C LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QHB16707 LinkDB All DBs Position 164371..164646 Genome browser AA seq 91 aa AA seqDB search MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARALSHNNNNPHHQHAQAATEAAEQTE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggtcaatctttacaagatccatatttgaatgcacttcgccgtgagcgtatt cctgtttcaatttatttagttaacggtattaaattacaaggtcagattgagtcgttcgac caattcgtcattttactaaaaaacacggtcagccaaatggtatataaacacgcgatttca actgttgtacctgctcgagcgttatcgcacaacaataacaacccccatcatcaacacgct caagctgcaacagaagcagctgaacaaacggaataa

DBGET integrated database retrieval system