KEGG   Mirounga angustirostris (Northern elephant seal): 123837233
Entry
123837233         CDS       T11530                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
mano  Mirounga angustirostris (Northern elephant seal)
Pathway
mano04014  Ras signaling pathway
mano04015  Rap1 signaling pathway
mano04020  Calcium signaling pathway
mano04022  cGMP-PKG signaling pathway
mano04024  cAMP signaling pathway
mano04070  Phosphatidylinositol signaling system
mano04114  Oocyte meiosis
mano04218  Cellular senescence
mano04261  Adrenergic signaling in cardiomyocytes
mano04270  Vascular smooth muscle contraction
mano04371  Apelin signaling pathway
mano04625  C-type lectin receptor signaling pathway
mano04713  Circadian entrainment
mano04720  Long-term potentiation
mano04722  Neurotrophin signaling pathway
mano04728  Dopaminergic synapse
mano04740  Olfactory transduction
mano04744  Phototransduction
mano04750  Inflammatory mediator regulation of TRP channels
mano04910  Insulin signaling pathway
mano04912  GnRH signaling pathway
mano04915  Estrogen signaling pathway
mano04916  Melanogenesis
mano04921  Oxytocin signaling pathway
mano04922  Glucagon signaling pathway
mano04924  Renin secretion
mano04925  Aldosterone synthesis and secretion
mano04970  Salivary secretion
mano04971  Gastric acid secretion
mano05010  Alzheimer disease
mano05012  Parkinson disease
mano05022  Pathways of neurodegeneration - multiple diseases
mano05031  Amphetamine addiction
mano05034  Alcoholism
mano05133  Pertussis
mano05152  Tuberculosis
mano05163  Human cytomegalovirus infection
mano05167  Kaposi sarcoma-associated herpesvirus infection
mano05170  Human immunodeficiency virus 1 infection
mano05200  Pathways in cancer
mano05214  Glioma
mano05417  Lipid and atherosclerosis
mano05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mano00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123837233
   04015 Rap1 signaling pathway
    123837233
   04371 Apelin signaling pathway
    123837233
   04020 Calcium signaling pathway
    123837233
   04070 Phosphatidylinositol signaling system
    123837233
   04024 cAMP signaling pathway
    123837233
   04022 cGMP-PKG signaling pathway
    123837233
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    123837233
   04218 Cellular senescence
    123837233
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123837233
  09152 Endocrine system
   04910 Insulin signaling pathway
    123837233
   04922 Glucagon signaling pathway
    123837233
   04912 GnRH signaling pathway
    123837233
   04915 Estrogen signaling pathway
    123837233
   04921 Oxytocin signaling pathway
    123837233
   04916 Melanogenesis
    123837233
   04924 Renin secretion
    123837233
   04925 Aldosterone synthesis and secretion
    123837233
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123837233
   04270 Vascular smooth muscle contraction
    123837233
  09154 Digestive system
   04970 Salivary secretion
    123837233
   04971 Gastric acid secretion
    123837233
  09156 Nervous system
   04728 Dopaminergic synapse
    123837233
   04720 Long-term potentiation
    123837233
   04722 Neurotrophin signaling pathway
    123837233
  09157 Sensory system
   04744 Phototransduction
    123837233
   04740 Olfactory transduction
    123837233
   04750 Inflammatory mediator regulation of TRP channels
    123837233
  09159 Environmental adaptation
   04713 Circadian entrainment
    123837233
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123837233
  09162 Cancer: specific types
   05214 Glioma
    123837233
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    123837233
   05163 Human cytomegalovirus infection
    123837233
   05167 Kaposi sarcoma-associated herpesvirus infection
    123837233
  09171 Infectious disease: bacterial
   05133 Pertussis
    123837233
   05152 Tuberculosis
    123837233
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123837233
   05012 Parkinson disease
    123837233
   05022 Pathways of neurodegeneration - multiple diseases
    123837233
  09165 Substance dependence
   05031 Amphetamine addiction
    123837233
   05034 Alcoholism
    123837233
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123837233
   05418 Fluid shear stress and atherosclerosis
    123837233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mano01009]
    123837233
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mano04131]
    123837233
   03036 Chromosome and associated proteins [BR:mano03036]
    123837233
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mano04147]
    123837233
Protein phosphatases and associated proteins [BR:mano01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     123837233
Membrane trafficking [BR:mano04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    123837233
Chromosome and associated proteins [BR:mano03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     123837233
Exosome [BR:mano04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   123837233
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EFhand_Ca_insen EF-hand_FSTL1 EF_EFCAB10_C Latarcin FCaBP_EF-hand EF-hand_11
Other DBs
NCBI-GeneID: 123837233
NCBI-ProteinID: XP_054361548
LinkDB
Position
Unknown
AA seq 126 aa
MRSLGQSPAEAELQDMINEGNADGHGTIDFPELLPMMARKMKDTDSEEEIRQAFQVFDKD
GNSYISAAELRHGMTKLGEKLMDEEDEMIREPGIDGDGQVSYDEFIQMMIAKRRPTFNSF
SSSRRI
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaggtcactgggtcagagcccagcagaagctgaattgcaggatatgatcaatgagggg
aatgctgatggtcatggcaccattgacttcccagagcttttgcctatgatggctagaaaa
atgaaagatacagacagtgaagaagaaatccgccaggcattccaagtctttgacaaggat
ggcaacagttacatcagtgcagcagagctacgtcatggcatgaccaagttaggagaaaaa
ctaatggatgaagaagatgaaatgatcagagaaccaggtattgatggagatggacaagtc
agctatgacgaattcatacagatgatgattgccaaacgaagacctactttcaactccttt
tcctcctctagaagaatctaa

DBGET integrated database retrieval system