KEGG   Mirounga angustirostris (Northern elephant seal): 123844599
Entry
123844599         CDS       T11530                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mano  Mirounga angustirostris (Northern elephant seal)
Pathway
mano01521  EGFR tyrosine kinase inhibitor resistance
mano01522  Endocrine resistance
mano01524  Platinum drug resistance
mano04010  MAPK signaling pathway
mano04012  ErbB signaling pathway
mano04014  Ras signaling pathway
mano04015  Rap1 signaling pathway
mano04022  cGMP-PKG signaling pathway
mano04024  cAMP signaling pathway
mano04062  Chemokine signaling pathway
mano04066  HIF-1 signaling pathway
mano04068  FoxO signaling pathway
mano04071  Sphingolipid signaling pathway
mano04072  Phospholipase D signaling pathway
mano04114  Oocyte meiosis
mano04140  Autophagy - animal
mano04148  Efferocytosis
mano04150  mTOR signaling pathway
mano04151  PI3K-Akt signaling pathway
mano04210  Apoptosis
mano04218  Cellular senescence
mano04261  Adrenergic signaling in cardiomyocytes
mano04270  Vascular smooth muscle contraction
mano04350  TGF-beta signaling pathway
mano04360  Axon guidance
mano04370  VEGF signaling pathway
mano04371  Apelin signaling pathway
mano04380  Osteoclast differentiation
mano04510  Focal adhesion
mano04517  IgSF CAM signaling
mano04520  Adherens junction
mano04540  Gap junction
mano04550  Signaling pathways regulating pluripotency of stem cells
mano04611  Platelet activation
mano04613  Neutrophil extracellular trap formation
mano04620  Toll-like receptor signaling pathway
mano04621  NOD-like receptor signaling pathway
mano04625  C-type lectin receptor signaling pathway
mano04650  Natural killer cell mediated cytotoxicity
mano04657  IL-17 signaling pathway
mano04658  Th1 and Th2 cell differentiation
mano04659  Th17 cell differentiation
mano04660  T cell receptor signaling pathway
mano04662  B cell receptor signaling pathway
mano04664  Fc epsilon RI signaling pathway
mano04666  Fc gamma R-mediated phagocytosis
mano04668  TNF signaling pathway
mano04713  Circadian entrainment
mano04720  Long-term potentiation
mano04722  Neurotrophin signaling pathway
mano04723  Retrograde endocannabinoid signaling
mano04724  Glutamatergic synapse
mano04725  Cholinergic synapse
mano04726  Serotonergic synapse
mano04730  Long-term depression
mano04810  Regulation of actin cytoskeleton
mano04910  Insulin signaling pathway
mano04912  GnRH signaling pathway
mano04914  Progesterone-mediated oocyte maturation
mano04915  Estrogen signaling pathway
mano04916  Melanogenesis
mano04917  Prolactin signaling pathway
mano04919  Thyroid hormone signaling pathway
mano04921  Oxytocin signaling pathway
mano04926  Relaxin signaling pathway
mano04928  Parathyroid hormone synthesis, secretion and action
mano04929  GnRH secretion
mano04930  Type II diabetes mellitus
mano04933  AGE-RAGE signaling pathway in diabetic complications
mano04934  Cushing syndrome
mano04935  Growth hormone synthesis, secretion and action
mano04960  Aldosterone-regulated sodium reabsorption
mano05010  Alzheimer disease
mano05020  Prion disease
mano05022  Pathways of neurodegeneration - multiple diseases
mano05034  Alcoholism
mano05132  Salmonella infection
mano05133  Pertussis
mano05135  Yersinia infection
mano05140  Leishmaniasis
mano05142  Chagas disease
mano05145  Toxoplasmosis
mano05152  Tuberculosis
mano05160  Hepatitis C
mano05161  Hepatitis B
mano05163  Human cytomegalovirus infection
mano05164  Influenza A
mano05165  Human papillomavirus infection
mano05166  Human T-cell leukemia virus 1 infection
mano05167  Kaposi sarcoma-associated herpesvirus infection
mano05170  Human immunodeficiency virus 1 infection
mano05171  Coronavirus disease - COVID-19
mano05200  Pathways in cancer
mano05203  Viral carcinogenesis
mano05205  Proteoglycans in cancer
mano05206  MicroRNAs in cancer
mano05207  Chemical carcinogenesis - receptor activation
mano05208  Chemical carcinogenesis - reactive oxygen species
mano05210  Colorectal cancer
mano05211  Renal cell carcinoma
mano05212  Pancreatic cancer
mano05213  Endometrial cancer
mano05214  Glioma
mano05215  Prostate cancer
mano05216  Thyroid cancer
mano05218  Melanoma
mano05219  Bladder cancer
mano05220  Chronic myeloid leukemia
mano05221  Acute myeloid leukemia
mano05223  Non-small cell lung cancer
mano05224  Breast cancer
mano05225  Hepatocellular carcinoma
mano05226  Gastric cancer
mano05230  Central carbon metabolism in cancer
mano05231  Choline metabolism in cancer
mano05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mano05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mano00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123844599 (MAPK3)
   04012 ErbB signaling pathway
    123844599 (MAPK3)
   04014 Ras signaling pathway
    123844599 (MAPK3)
   04015 Rap1 signaling pathway
    123844599 (MAPK3)
   04350 TGF-beta signaling pathway
    123844599 (MAPK3)
   04370 VEGF signaling pathway
    123844599 (MAPK3)
   04371 Apelin signaling pathway
    123844599 (MAPK3)
   04668 TNF signaling pathway
    123844599 (MAPK3)
   04066 HIF-1 signaling pathway
    123844599 (MAPK3)
   04068 FoxO signaling pathway
    123844599 (MAPK3)
   04072 Phospholipase D signaling pathway
    123844599 (MAPK3)
   04071 Sphingolipid signaling pathway
    123844599 (MAPK3)
   04024 cAMP signaling pathway
    123844599 (MAPK3)
   04022 cGMP-PKG signaling pathway
    123844599 (MAPK3)
   04151 PI3K-Akt signaling pathway
    123844599 (MAPK3)
   04150 mTOR signaling pathway
    123844599 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    123844599 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123844599 (MAPK3)
   04148 Efferocytosis
    123844599 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    123844599 (MAPK3)
   04210 Apoptosis
    123844599 (MAPK3)
   04218 Cellular senescence
    123844599 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    123844599 (MAPK3)
   04520 Adherens junction
    123844599 (MAPK3)
   04540 Gap junction
    123844599 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    123844599 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123844599 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123844599 (MAPK3)
   04613 Neutrophil extracellular trap formation
    123844599 (MAPK3)
   04620 Toll-like receptor signaling pathway
    123844599 (MAPK3)
   04621 NOD-like receptor signaling pathway
    123844599 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    123844599 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    123844599 (MAPK3)
   04660 T cell receptor signaling pathway
    123844599 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    123844599 (MAPK3)
   04659 Th17 cell differentiation
    123844599 (MAPK3)
   04657 IL-17 signaling pathway
    123844599 (MAPK3)
   04662 B cell receptor signaling pathway
    123844599 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    123844599 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    123844599 (MAPK3)
   04062 Chemokine signaling pathway
    123844599 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123844599 (MAPK3)
   04929 GnRH secretion
    123844599 (MAPK3)
   04912 GnRH signaling pathway
    123844599 (MAPK3)
   04915 Estrogen signaling pathway
    123844599 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    123844599 (MAPK3)
   04917 Prolactin signaling pathway
    123844599 (MAPK3)
   04921 Oxytocin signaling pathway
    123844599 (MAPK3)
   04926 Relaxin signaling pathway
    123844599 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    123844599 (MAPK3)
   04919 Thyroid hormone signaling pathway
    123844599 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    123844599 (MAPK3)
   04916 Melanogenesis
    123844599 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123844599 (MAPK3)
   04270 Vascular smooth muscle contraction
    123844599 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123844599 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    123844599 (MAPK3)
   04725 Cholinergic synapse
    123844599 (MAPK3)
   04726 Serotonergic synapse
    123844599 (MAPK3)
   04720 Long-term potentiation
    123844599 (MAPK3)
   04730 Long-term depression
    123844599 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    123844599 (MAPK3)
   04722 Neurotrophin signaling pathway
    123844599 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    123844599 (MAPK3)
   04380 Osteoclast differentiation
    123844599 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    123844599 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123844599 (MAPK3)
   05206 MicroRNAs in cancer
    123844599 (MAPK3)
   05205 Proteoglycans in cancer
    123844599 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    123844599 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    123844599 (MAPK3)
   05203 Viral carcinogenesis
    123844599 (MAPK3)
   05230 Central carbon metabolism in cancer
    123844599 (MAPK3)
   05231 Choline metabolism in cancer
    123844599 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123844599 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123844599 (MAPK3)
   05212 Pancreatic cancer
    123844599 (MAPK3)
   05225 Hepatocellular carcinoma
    123844599 (MAPK3)
   05226 Gastric cancer
    123844599 (MAPK3)
   05214 Glioma
    123844599 (MAPK3)
   05216 Thyroid cancer
    123844599 (MAPK3)
   05221 Acute myeloid leukemia
    123844599 (MAPK3)
   05220 Chronic myeloid leukemia
    123844599 (MAPK3)
   05218 Melanoma
    123844599 (MAPK3)
   05211 Renal cell carcinoma
    123844599 (MAPK3)
   05219 Bladder cancer
    123844599 (MAPK3)
   05215 Prostate cancer
    123844599 (MAPK3)
   05213 Endometrial cancer
    123844599 (MAPK3)
   05224 Breast cancer
    123844599 (MAPK3)
   05223 Non-small cell lung cancer
    123844599 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123844599 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    123844599 (MAPK3)
   05161 Hepatitis B
    123844599 (MAPK3)
   05160 Hepatitis C
    123844599 (MAPK3)
   05171 Coronavirus disease - COVID-19
    123844599 (MAPK3)
   05164 Influenza A
    123844599 (MAPK3)
   05163 Human cytomegalovirus infection
    123844599 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123844599 (MAPK3)
   05165 Human papillomavirus infection
    123844599 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    123844599 (MAPK3)
   05135 Yersinia infection
    123844599 (MAPK3)
   05133 Pertussis
    123844599 (MAPK3)
   05152 Tuberculosis
    123844599 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    123844599 (MAPK3)
   05140 Leishmaniasis
    123844599 (MAPK3)
   05142 Chagas disease
    123844599 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123844599 (MAPK3)
   05020 Prion disease
    123844599 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    123844599 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    123844599 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123844599 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    123844599 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    123844599 (MAPK3)
   04934 Cushing syndrome
    123844599 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123844599 (MAPK3)
   01524 Platinum drug resistance
    123844599 (MAPK3)
   01522 Endocrine resistance
    123844599 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mano01001]
    123844599 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mano03036]
    123844599 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mano04147]
    123844599 (MAPK3)
Enzymes [BR:mano01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     123844599 (MAPK3)
Protein kinases [BR:mano01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   123844599 (MAPK3)
Chromosome and associated proteins [BR:mano03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     123844599 (MAPK3)
Exosome [BR:mano04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123844599 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 123844599
NCBI-ProteinID: XP_045731224
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAY
DHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccc
cgctacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctccgcttac
gaccacgtgcgcaagattcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgcgagatccagatcttgctgcgcttccgccacgagaacgtc
attggcattcgggacattctgcgggcacccaccctggaagccatgagggatgtctacatc
gtgcaggacctgatggagacagacctctacaagttgctgaaaagccagcagctgagcaac
gaccatgtttgctacttcctctaccagatcttgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctctccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagac
tccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaagaagcactggctcacccctacttggagcagtactacgacccaacagatgagcca
gtggctgaggagcctttcaccttcgacatggagctggatgatctacccaaggaacggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system