Marinobacter sp. NP-4(2019): EHN06_02395 Help Entry EHN06_02395       CDS       T09527                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism manp  Marinobacter sp. NP-4(2019) Pathway manp00361   Chlorocyclohexane and chlorobenzene degradation manp00362   Benzoate degradation manp00623   Toluene degradation manp01100   Metabolic pathways manp01120   Microbial metabolism in diverse environments manp01220   Degradation of aromatic compounds Module manp_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:manp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     EHN06_02395    00361 Chlorocyclohexane and chlorobenzene degradation     EHN06_02395    00623 Toluene degradation     EHN06_02395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  AZT82481 UniProt:  A0A3Q9NK56 LinkDB All DBs Position 541225..541476 Genome browser AA seq 83 aa AA seqDB search MTNQAKSFDDMPRYIRVRSGPEDRFVEFDFAIGYPELFVELVLPRNAFEIFCRHNKVIHM DSDMIREIDADMIKWRFGEKGHR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccaagcgaaaagcttcgacgacatgccccggtatatccgggtgcgcagtggg ccggaagacaggttcgtggagttcgactttgccatcggctaccccgaactgtttgttgag ctcgtgcttccacggaatgccttcgagattttctgccggcataacaaggtgatccacatg gattccgacatgatccgcgagatcgatgccgacatgatcaagtggcgtttcggagagaaa ggccaccgttaa

DBGET integrated database retrieval system