Marinobacter sp. NP-4(2019): EHN06_02405 Help Entry EHN06_02405       CDS       T09527                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism manp  Marinobacter sp. NP-4(2019) Pathway manp00361   Chlorocyclohexane and chlorobenzene degradation manp00362   Benzoate degradation manp00623   Toluene degradation manp01100   Metabolic pathways manp01120   Microbial metabolism in diverse environments manp01220   Degradation of aromatic compounds Module manp_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:manp00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     EHN06_02405    00361 Chlorocyclohexane and chlorobenzene degradation     EHN06_02405    00623 Toluene degradation     EHN06_02405 Enzymes [BR:manp01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      EHN06_02405     1.14.13.244  phenol 2-monooxygenase (NADH)      EHN06_02405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  AZT82483 UniProt:  A0A3Q9NG22 LinkDB All DBs Position 542524..542793 Genome browser AA seq 89 aa AA seqDB search MSQLVFIAFQDNDNARYLVEAIAEDNPEAEVQHQPAMIRIQAEKRLVINRETMEEKLGRD WDVQEMLIDVISIGGNVDEDDDHFILQWT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagccagctcgtatttatcgccttccaggacaacgacaacgcccgctatctggtggaa gccattgctgaagacaacccggaagcagaggttcagcaccagccggcaatgatccggatc caggcggaaaagcgcctggtaatcaaccgcgaaaccatggaagaaaagcttggtcgtgac tgggacgtgcaggagatgctgatcgacgtgattagtatcggcggcaatgtcgacgaagac gacgaccacttcattcttcagtggacctga

DBGET integrated database retrieval system