Methanomicrobium antiquum: L1994_10515 Help Entry L1994_10515       CDS       T08973                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism manq  Methanomicrobium antiquum Pathway manq03010   Ribosome Brite KEGG Orthology (KO) [BR:manq00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L1994_10515   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     L1994_10515  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:manq03011]     L1994_10515    04121 Ubiquitin system [BR:manq04121]     L1994_10515   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:manq04147]     L1994_10515 Ribosome [BR:manq03011]  Ribosomal proteins   Eukaryotes    Small subunit     L1994_10515   Archaea     L1994_10515 Ubiquitin system [BR:manq04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    L1994_10515 Exosome [BR:manq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    L1994_10515   Exosomal proteins of colorectal cancer cells    L1994_10515 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 Ribosomal_L37e Phage_gp86 IBR Lar_restr_allev zf-HYPF DUF3027 DUF1451 Zn_ribbon_RPAB4 Zn_ribbon_13 Cas12f1-like_TNB Zn_ribbon_IS1595 Motif Other DBs NCBI-ProteinID:  WFN36558 UniProt:  A0AAF0FL71 LinkDB All DBs Position complement(2146244..2146426) Genome browser AA seq 60 aa AA seqDB search MAAKKQQTKSAVKRSSMYKVEGDKAVAQRRNCPRCGPGVFMAQHSDRVACGKCGYTEFNK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcggcaaagaaacaacagacaaaatctgctgttaaacgctcatccatgtacaaggtt gagggcgacaaggctgtagcacagcgcagaaactgcccacgctgcggtcccggtgtattc atggcacagcacagcgatcgtgttgcatgcggcaagtgcggatatacagaattcaacaaa taa

DBGET integrated database retrieval system