Marisediminicola antarctica: BHD05_02125 Help Entry BHD05_02125       CDS       T06401                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism mant  Marisediminicola antarctica Brite KEGG Orthology (KO) [BR:mant00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mant03032]     BHD05_02125    03036 Chromosome and associated proteins [BR:mant03036]     BHD05_02125    03400 DNA repair and recombination proteins [BR:mant03400]     BHD05_02125 DNA replication proteins [BR:mant03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BHD05_02125 Chromosome and associated proteins [BR:mant03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BHD05_02125 DNA repair and recombination proteins [BR:mant03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BHD05_02125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 PSF3_N Motif Other DBs NCBI-ProteinID:  QHO68604 UniProt:  A0A7L5AGU8 LinkDB All DBs Position 452670..452957 Genome browser AA seq 95 aa AA seqDB search MADKSLNRTELVAAVAAESGQSQAAVNGVLDALFSTLATSVGEGTKVTIPGWLAIERTHR AARAGRNPSTGEAIQIAAGYGVKVSAGSKLKAAAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtcactgaaccgcaccgagctcgtcgcagcagtagccgcagagtctggc cagagccaggccgcagtgaacggcgtgctcgacgcactgttctcgaccctcgcgacctcg gtcggcgaaggcaccaaggtcacgatcccgggatggctcgccattgagcgcacccaccgt gccgctcgcgccggacgcaacccgtccacgggtgaggccatccagatcgccgccggatac ggtgtcaaggtcagcgccggcagcaagctcaaggccgccgcgaagtaa

DBGET integrated database retrieval system