Marisediminicola antarctica: BHD05_13640 Help Entry BHD05_13640       CDS       T06401                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mant  Marisediminicola antarctica Brite KEGG Orthology (KO) [BR:mant00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BHD05_13640 Enzymes [BR:mant01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BHD05_13640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin Thioredoxin_2 Glrx-like GST_N_2 DUF3088 BFA1_C Motif Other DBs NCBI-ProteinID:  QHO70536 UniProt:  A0A7L5AKD9 LinkDB All DBs Position 2940762..2941019 Genome browser AA seq 85 aa AA seqDB search MNYTPDAGGITMFSTPWCGYCTRLKSQLTKAGIAYRDIDIEAVPGTAELVATINGGNQTV PTVLFPDGSSATNPSLAEVTARLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaactacacccccgacgccggcggcatcacgatgttctccaccccgtggtgcggctac tgcacgcgactgaagtcgcagctgaccaaagcgggcatcgcgtaccgcgacatcgacatc gaagccgttcccggaacagccgaactcgtcgcgacgatcaacggcggaaaccagacggtg ccgaccgtgctgttccctgacgggtcgtcggcgaccaatccctcgctcgcggaggtcacg gcacgcctcgcggcgtga

DBGET integrated database retrieval system