Methanofollis aquaemaris: RJ40_03290 Help Entry RJ40_03290        CDS       T08618                                  Name (GenBank) histone family protein   KO K24450   DNA-binding protein Organism maqe  Methanofollis aquaemaris Brite KEGG Orthology (KO) [BR:maqe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maqe03036]     RJ40_03290 Chromosome and associated proteins [BR:maqe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RJ40_03290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa CENP-S Bromo_TP CoaE Motif Other DBs NCBI-ProteinID:  QSZ66589 UniProt:  A0A8A3S3Y5 LinkDB All DBs Position complement(705006..705215) Genome browser AA seq 69 aa AA seqDB search MSELPIAPVGRIIKNAGAERVSADGSEALAALMEEYGTQMAREAIKLTRHAGRKTVKAVD IKMASEILR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagtgaactacctattgccccggttggcaggattatcaagaacgccggtgctgagcgc gtcagcgccgatgggagtgaggcgcttgctgcgctcatggaagaatatggaactcagatg gcgagggaagcgatcaaactcaccaggcatgccggccgcaagactgtgaaggcggtcgac atcaagatggcatctgagattctcaggtga

DBGET integrated database retrieval system