Methanofollis aquaemaris: RJ40_07130 Help Entry RJ40_07130        CDS       T08618                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism maqe  Methanofollis aquaemaris Pathway maqe03010   Ribosome Brite KEGG Orthology (KO) [BR:maqe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     RJ40_07130   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     RJ40_07130  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:maqe03011]     RJ40_07130    04121 Ubiquitin system [BR:maqe04121]     RJ40_07130 Ribosome [BR:maqe03011]  Ribosomal proteins   Eukaryotes    Large subunit     RJ40_07130   Archaea     RJ40_07130 Ubiquitin system [BR:maqe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    RJ40_07130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR Cas12f1-like_TNB zf-AtTam37 Zn_ribbon_3 Ribosomal_L37e Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  QSZ67291 UniProt:  A0A8A3S6E3 LinkDB All DBs Position 1486846..1486992 Genome browser AA seq 48 aa AA seqDB search MARFPEAEARLLNVKICMRCNARNAVRATQCRKCGYKHLRPKNKDRKA NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atggcacggttccccgaagctgaagcacggctgctcaatgtcaagatctgcatgcgttgc aacgcacggaacgcggtacgggcaacacagtgtcgcaagtgcggctacaagcacctgcgc ccaaagaacaaggaccgcaaggcctga

DBGET integrated database retrieval system