Flagellimonas marinaquae: LDL77_17020 Help Entry LDL77_17020       CDS       T07803                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism maqi  Flagellimonas marinaquae Pathway maqi01100   Metabolic pathways maqi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maqi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LDL77_17020    00074 Mycolic acid biosynthesis     LDL77_17020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LDL77_17020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UBZ13571 LinkDB All DBs Position complement(3820301..3820546) Genome browser AA seq 81 aa AA seqDB search MTNDEKILAELKEIFIETLGHDNFELDGNTTANDVDGWDSVTHMMLINEVEKKYDMKFSL MDLMSLEKVADLVKAIEQRQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgaacgacgaaaagatactggctgaactgaaagaaatattcatagagacccttggt catgataattttgagctcgatggcaacaccacggccaatgatgtggacggttgggattcc gtgacacatatgatgctcatcaatgaggtcgagaagaaatatgacatgaagttctcttta atggacctgatgagcctagaaaaagtagcagatctggtaaaggctatagaacaaaggcaa tcctaa

DBGET integrated database retrieval system