Methylobacterium aquaticum: Maq22A_c21215 Help Entry Maq22A_c21215     CDS       T04311                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism maqu  Methylobacterium aquaticum Pathway maqu00998   Biosynthesis of various antibiotics maqu01100   Metabolic pathways maqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Maq22A_c21215 (acpP)    00074 Mycolic acid biosynthesis     Maq22A_c21215 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Maq22A_c21215 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 ACP_SdgA_C DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  BAQ47267 UniProt:  A0A0C6FJS2 LinkDB All DBs Position complement(4120156..4120392) Genome browser AA seq 78 aa AA seqDB search MSDIADRVKKIVVDHLGVEPEKVTPNANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNAG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcggaccgggtgaagaagatcgtcgtcgatcacctgggcgtcgagccc gagaaggtgaccccgaacgcgaacttcatcgacgatctgggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaagagttcaacgtcgagatcccggacgacgccgcc gagacgatccagacggtcggcgacgcgatcaagttcctcgagaagaacgccggctga

DBGET integrated database retrieval system