Microcystis aeruginosa: MAE_14950 Help Entry MAE_14950         CDS       T00647                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mar  Microcystis aeruginosa Pathway mar00998   Biosynthesis of various antibiotics mar01100   Metabolic pathways mar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MAE_14950 (acpP)    00074 Mycolic acid biosynthesis     MAE_14950 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MAE_14950 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  BAG01317 UniProt:  B0JUC9 LinkDB All DBs Position 1336836..1337084 Genome browser AA seq 82 aa AA seqDB search MSEGIFDRVKKVVVEQLEVEPEKVTPDASFANDLQADSLDVVELVMALEEEFDIEIPDEA AEQIDTVGKAVDHISEKVGATA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaggtattttcgatcgagttaaaaaagttgttgtggaacaattagaagtagag ccggaaaaagttactcccgacgcaagctttgctaatgatctgcaagctgattcccttgat gtggtcgagttagtgatggctttagaggaagaatttgatattgaaattcccgacgaagcg gccgaacaaattgacactgtaggcaaagctgttgaccatattagcgagaaagtaggagca accgcctaa

DBGET integrated database retrieval system