Marinobacter sp. Arc7-DN-1: D0851_04290 Help Entry D0851_04290       CDS       T05619                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mara  Marinobacter sp. Arc7-DN-1 Pathway mara01100   Metabolic pathways mara01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mara00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0851_04290    00074 Mycolic acid biosynthesis     D0851_04290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0851_04290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  AXS85179 UniProt:  A0A346S6F3 LinkDB All DBs Position complement(929809..930042) Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNSSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLASVQDAIDYIVAHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgttaagaagatcgtttgtgaacagttgggcgttaaagag tccgaggttcagaactcatcttcttttgtagaggatcttggcgctgactcactggacacc gttgagctggttatggccctggaagaggaatttgaaaccgagattcctgatgaggaagcc gagaagctggcaagtgttcaggacgcgatcgactacatcgtcgcgcacacctga

DBGET integrated database retrieval system