Marinobacter sp. Arc7-DN-1: D0851_19810 Help Entry D0851_19810       CDS       T05619                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism mara  Marinobacter sp. Arc7-DN-1 Brite KEGG Orthology (KO) [BR:mara00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mara03036]     D0851_19810 Chromosome and associated proteins [BR:mara03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     D0851_19810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB CENP-H YabA SlyX Motif Other DBs NCBI-ProteinID:  AXS85059 UniProt:  A0A346S633 LinkDB All DBs Position 4235601..4235873 Genome browser AA seq 90 aa AA seqDB search MKLLWTLMVVAILLLQVRLWVGEGSFAQVWALEQSIAEQRKENAELATRNERLYAEVRNL RNEQGAVEERARMNLGLIREDETFFLVVEN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagttgctctggaccctaatggtggttgcgattctcctgctccaggtgcgcctgtgg gtcggggaaggcagctttgcgcaggtgtgggcactcgagcagtccattgctgagcaacgt aaagaaaatgccgaactggctacccgcaatgaacgtctctatgccgaggtcaggaatttg cgcaacgagcagggcgccgtcgaagaacgggccaggatgaaccttggcctgatcagggaa gacgagacctttttcctcgttgtcgaaaactga

DBGET integrated database retrieval system