Maribacter cobaltidurans: CJ263_06045 Help Entry CJ263_06045       CDS       T05023                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism marb  Maribacter cobaltidurans Pathway marb01100   Metabolic pathways marb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:marb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ263_06045    00074 Mycolic acid biosynthesis     CJ263_06045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ263_06045 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  ASV32583 UniProt:  A0A223VB38 LinkDB All DBs Position 1426238..1426480 Genome browser AA seq 80 aa AA seqDB search MTKQTIIEKINDFLIEDFEVEEEELEPSANLKDTIGLDSLDFVDLVVAVESNFGVKLVGE DFVGVTTLQDFYNLIDRKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccaaacaaaccataatcgagaagatcaacgatttcttgatcgaagactttgaagta gaggaggaagaattggaacccagtgcaaatctaaaggacaccataggtttggacagtttg gattttgtagatttagtggttgccgtagagagcaattttggagttaaattggtaggtgag gacttcgttggtgttactacattacaggacttctataatcttattgacagaaaactgggt taa

DBGET integrated database retrieval system