Methanogenic archaeon ISO4-H5: AR505_1370 Help Entry AR505_1370        CDS       T04272                                  Name (GenBank) ribosomal protein S27e Rps27e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism marc  Methanogenic archaeon ISO4-H5 Pathway marc03010   Ribosome Brite KEGG Orthology (KO) [BR:marc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AR505_1370   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AR505_1370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:marc03011]     AR505_1370    04121 Ubiquitin system [BR:marc04121]     AR505_1370   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:marc04147]     AR505_1370 Ribosome [BR:marc03011]  Ribosomal proteins   Eukaryotes    Small subunit     AR505_1370   Archaea     AR505_1370 Ubiquitin system [BR:marc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AR505_1370 Exosome [BR:marc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AR505_1370   Exosomal proteins of colorectal cancer cells    AR505_1370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e DUF1451 Zn_ribbon_IS1595 Zn_ribbon_13 Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  AMH95085 UniProt:  A0A120MID1 LinkDB All DBs Position complement(1458989..1459177) Genome browser AA seq 62 aa AA seqDB search MAAKKPAVKKPIQKKDAYKVEGDSVTRTKPVCPKCGPGTFMAVHKDRTSCGRCGYTEFNN KE NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggcagcaaagaaacctgcagtgaagaaacccattcagaagaaagacgcatacaaggtc gagggcgactccgttacaaggaccaagcccgtctgccccaagtgcggacccggaaccttc atggccgtccacaaggaccgtacctcctgcggacgctgcggttacaccgagttcaacaac aaagagtga

DBGET integrated database retrieval system