Maribacter sp. MJ134: EJ994_12905 Help Entry EJ994_12905       CDS       T05877                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mare  Maribacter sp. MJ134 Pathway mare00190   Oxidative phosphorylation mare01100   Metabolic pathways Module mare_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mare00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EJ994_12905 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mare00194]     EJ994_12905 (atpE) Photosynthesis proteins [BR:mare00194]  Photosystem and electron transport system   F-type ATPase [OT]    EJ994_12905 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C SpoIIM Motif Other DBs NCBI-ProteinID:  AZQ59662 UniProt:  A0A3S9NUM8 LinkDB All DBs Position complement(2985668..2985862) Genome browser AA seq 64 aa AA seqDB search MMEIPAIVGAGLAVIGVGMGIGRIGGSAMDAIARQPEAYGKIQTAMLIAAALIEGIGFAA IFAS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt attatggaaattccagcaattgtaggtgcaggtttagcggttatcggagtaggtatggga attggtagaatcggtggttctgccatggatgctatcgctcgtcagccagaagcttatggt aagattcaaacagctatgttgattgcagcagcacttattgaagggattggtttcgctgca atttttgcatcctaa

DBGET integrated database retrieval system