Mariniflexile rhizosphaerae: CJ739_1651 Help Entry CJ739_1651        CDS       T05592                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism marf  Mariniflexile rhizosphaerae Pathway marf01100   Metabolic pathways marf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:marf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ739_1651    00074 Mycolic acid biosynthesis     CJ739_1651   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ739_1651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 InlK_D3 Motif Other DBs NCBI-ProteinID:  AXP80737 LinkDB All DBs Position complement(1881088..1881321) Genome browser AA seq 77 aa AA seqDB search MSDIASRVKAIIVDKLGVDENEVVTEASFTNDLGADSLDTVELIMEFEKEFDIQIPDDQA ENIATVGQAISYIEAAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcagacattgcatcaagagtaaaagcgattatcgtagacaaattaggagttgatgag aacgaagttgtaactgaagcaagcttcacaaacgatttaggagcagactctttagacact gtagaattaataatggaattcgaaaaagagttcgatattcaaattccagatgatcaagct gaaaatattgcaacagttggtcaagctatctcttatatagaagctgcaaaataa

DBGET integrated database retrieval system