Marinobacter sp. CP1: ACP86_06735
Help
Entry
ACP86_06735 CDS
T04052
Name
(GenBank) transporter
KO
K03321
sulfate permease, SulP family
Organism
mari
Marinobacter sp. CP1
Brite
KEGG Orthology (KO) [BR:
mari00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mari02000
]
ACP86_06735
Transporters [BR:
mari02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
ACP86_06735
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
MFS_MOT1
STAS_2
Motif
Other DBs
NCBI-ProteinID:
AKV95869
LinkDB
All DBs
Position
complement(1420574..1422325)
Genome browser
AA seq
583 aa
AA seq
DB search
MPHRAHLFSLRMAHAFREACIDEPYRGRRFLRDVMAGLTVGIIAIPLAMALAIASGVAPQ
YGLYTAIIAGFVIALTGGSRFSISGPTAAFVVILYPIAQSYGLGGLLLATLMSGVLLILM
ALMRLGRFIEYIPESVTLGFTGGIAVVIATLQIRDFLGLQVGDMPEHYWDKLALLTGALP
EFDGMSTLVAGVTLACMLLWPRLKTPVPPHLPAVVIGSLLTLWLNAQGAAIDTIGSRFSY
LLPDGTEGAGIPPFLPEFAWPWQQAGASGEPVGLSWSLVRDLLPAAFAIAMLGAIESLLC
AVVLDGMTGKRHSANSELMGQGLGNIITPFFGGITATAAIARSAANYRAGAESPVSAMVH
SLVVLLALVSLAGLLAYLPMPAMAALLVMVAWNMSEAPKSLHLLKTAPRSDILVFLTCFS
LTVLLDMVIAITTGVLLAAVLFMREMAQMTRVTDITQSKRIAESRLPDGWQVFKINGPLF
FAAADRIFGELAVLARNARGFILYMDGVTILDAGGLSALNKLIATCERDGTQIVIADLQF
QPLRTLARAGVAPIAGVSRYTSSLDEALRLISCPASETDRASG
NT seq
1752 nt
NT seq
+upstream
nt +downstream
nt
atgccgcatcgagcccaccttttttctctccggatggcccacgcattccgggaagcgtgt
attgatgagccctaccggggccgccgtttcctgcgcgatgtgatggcgggtttgacggtg
ggcattattgccatacccctggccatggcattggcgatcgccagtggtgttgcaccccag
tacggcctctacaccgccattattgccgggtttgtgatcgcattgaccggtggcagccgg
ttcagcatctccggccccaccgctgctttcgttgtcattctgtaccccatcgcccagagc
tatgggctgggcggtctgcttttggccaccttgatgtcgggcgttttgctgattctgatg
gctctgatgcgactgggtcgttttatcgaatacattccagaatcggtaaccctcgggttt
accggggggatcgccgtggtgattgccaccctgcagatccgggattttctgggccttcag
gttggcgatatgcccgagcattattgggacaagctggccctgctgaccggtgcgctgccg
gaatttgatggtatgagtaccctggtggccggtgtcacccttgcctgcatgttgctctgg
ccacgcctgaaaaccccggtgcccccgcatctgccagcggtggtgatcggaagcctgctt
acgctctggttgaatgcccagggtgctgctatcgataccattggttcaaggttcagttat
ctcctgccggacggcaccgagggagcgggtattccgccgttcttgccggaattcgcctgg
ccgtggcagcaggcaggggcatcgggcgagcccgtcgggctgtcatggtcgctggtccgg
gatctgctgccggcagcttttgccattgccatgcttggggccatcgagtctctcctgtgc
gccgtggtgcttgatggcatgactggcaaacgccacagcgccaacagcgagctcatgggg
cagggccttggcaacatcatcacgccgtttttcggcggcattaccgccacggccgccatc
gcccgctcggcggccaactaccgggccggcgccgagtcgccggtctccgcaatggtgcat
tcgctggtcgttctgctggcgctggtttcgctggcgggcctgctggcgtatcttcccatg
ccggccatggccgccctgctggtgatggtggcctggaatatgagtgaggcccccaagtcc
ctgcatcttctgaaaaccgcgccgcgcagcgacatcctggtttttctcacctgcttttca
ctgacggtattgctcgacatggtcattgccatcaccaccggcgtcctgttggcggcggtc
ctgttcatgcgggaaatggcccagatgacccgggttacagatatcacccagagcaaacgg
attgcagaatcccggctgcccgatggctggcaggtgttcaagataaacggccccctgttt
tttgccgctgcggaccggattttcggggaactggcagtgctcgcccggaacgcccgcgga
ttcattctgtacatggacggcgtgacgattctcgatgccggcgggctgtccgctttgaac
aagcttattgctacctgtgaacgggacggtacacagattgtgattgccgatcttcagttc
cagcctttgcgcaccctcgctcgtgccggggttgcgccgatagctggcgttagccgctat
acttcctccctggacgaagctttgcgtctgatcagttgccctgcgtctgaaactgatcgg
gcttccggataa
DBGET
integrated database retrieval system