Marinobacter sp. JH2: MARI_07070 Help Entry MARI_07070        CDS       T06162                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism marj  Marinobacter sp. JH2 Brite KEGG Orthology (KO) [BR:marj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:marj03036]     MARI_07070 (ftsB) Chromosome and associated proteins [BR:marj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MARI_07070 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ZapB DUF2681 SlyX Motif Other DBs NCBI-ProteinID:  QBM16619 LinkDB All DBs Position 760122..760394 Genome browser AA seq 90 aa AA seqDB search MKTLWAILAVLILLLQVRLWVGEGSFAQVWALEEAIAKQQAENAGLAARNDRLYAEVRNL RNQQGAVEERARMNLGLIRDDETFFLVVEK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaaacgctttgggccattcttgctgtgctgatactcctgctacaggttcgcctgtgg gtcggggagggtagctttgcgcaagtttgggcactggaagaggcgattgctaagcagcaa gctgagaatgccgggctggcggctcggaatgaccggctttatgcagaggttcgtaacttg cgtaatcagcagggggcggtggaagagcgggcccgcatgaacctgggcttgattcgggac gatgagacgtttttcctcgttgtcgaaaagtaa

DBGET integrated database retrieval system