Marinobacter sp. JH2: MARI_32170 Help Entry MARI_32170        CDS       T06162                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism marj  Marinobacter sp. JH2 Brite KEGG Orthology (KO) [BR:marj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:marj03036]     MARI_32170 Chromosome and associated proteins [BR:marj03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MARI_32170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Filament Tropomyosin RecG_N Tlp Taxilin GapR_DNA-bd ATS TSC22 DUF724 SlyX Motif Other DBs NCBI-ProteinID:  QBM19074 LinkDB All DBs Position complement(3513494..3513700) Genome browser AA seq 68 aa AA seqDB search MEQSEVQLLADKLDKLIERCEKLERDNALLRETQDDWNRERAQLMQKNDLAKNKIEAMIG RLRALEHH NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaacagtccgaagtacagttgttagcggacaagctggacaagttgatcgagcgctgc gaaaaactcgagagagacaacgctttactgcgagaaacgcaggacgattggaatcgtgag cgagcccagcttatgcaaaaaaacgatcttgctaaaaacaagattgaagccatgattggt cgccttcgggcactggagcaccactga

DBGET integrated database retrieval system