Methanobrevibacter arboriphilus: MarbSA_20560 Help Entry MarbSA_20560      CDS       T07510                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism maro  Methanobrevibacter arboriphilus Pathway maro03010   Ribosome Brite KEGG Orthology (KO) [BR:maro00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MarbSA_20560   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MarbSA_20560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:maro03011]     MarbSA_20560    04121 Ubiquitin system [BR:maro04121]     MarbSA_20560   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maro04147]     MarbSA_20560 Ribosome [BR:maro03011]  Ribosomal proteins   Eukaryotes    Small subunit     MarbSA_20560   Archaea     MarbSA_20560 Ubiquitin system [BR:maro04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MarbSA_20560 Exosome [BR:maro04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MarbSA_20560   Exosomal proteins of colorectal cancer cells    MarbSA_20560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Phage_zn_bind_2 Ribosomal_L37e Zn_ribbon_Nudix Zn_ribbon_NUD Zn_ribbon_IS1595 Zn_Ribbon_TF Zn_ribbon_TiaS Zn_ribbon_RPB9 Motif Other DBs NCBI-ProteinID:  BBL63016 LinkDB All DBs Position 2378078..2378233 Genome browser AA seq 51 aa AA seqDB search MKKSTLYEVDGDKLKRKNPFCPRCSGGVFMADHGDRYACGKCGYTEIKNKD NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaatctacactttacgaagttgatggtgataaattaaaaaggaaaaatccgttt tgtcctcgttgttctggtggtgtatttatggctgatcatggtgatagatatgcttgtgga aaatgtggatatactgagattaaaaacaaagattaa

DBGET integrated database retrieval system