Marinobacterium aestuarii: A8C75_08500 Help Entry A8C75_08500       CDS       T04398                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mars  Marinobacterium aestuarii Pathway mars01100   Metabolic pathways mars01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mars00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A8C75_08500    00074 Mycolic acid biosynthesis     A8C75_08500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A8C75_08500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANG62525 UniProt:  A0A1A9EXC4 LinkDB All DBs Position 1915150..1915398 Genome browser AA seq 82 aa AA seqDB search MDYETTVKNLLIAATARGDIALMDRDAPLIGHVAELDSMAIVTFLTTLEDEFGILIDDDD VSAECFETLGALVNFVTEHLGR NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggattatgaaacgactgtaaaaaatctgctgatagccgccacggccagaggcgatatc gccttgatggatcgcgatgccccgttgatcggacatgttgccgaactggactcaatggcc atagtcacctttctcaccaccctggaggacgagttcggaatccttatcgacgacgatgac gttagtgccgaatgctttgaaaccctgggcgcactggtgaattttgtgacggagcatttg ggcaggtga

DBGET integrated database retrieval system