Palleronia sp. THAF1: FIU81_06155 Help Entry FIU81_06155       CDS       T06247                                  Symbol acpP1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism maru  Palleronia sp. THAF1 Pathway maru01100   Metabolic pathways maru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maru00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIU81_06155 (acpP1)    00074 Mycolic acid biosynthesis     FIU81_06155 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIU81_06155 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N TMEM210 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QFU08251 UniProt:  A0A5P9J7Y3 LinkDB All DBs Position 1196542..1196781 Genome browser AA seq 79 aa AA seqDB search MSEAEIEQRVRNKVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDD AAENIQTFGDAVNYIKGAV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagccgagatcgaacagcgcgtccggaacaaagtcgtcgagcacctcggcgtc gaagaagacaaggtgaccgagaacgcctctttcatcgatgatctgggtgcggacagcctc gacaccgtcgaactggtcatggccttcgaggaagagttcgggatcgaaatccccgacgac gccgccgagaacatccagacgttcggcgatgcggtcaactacatcaagggtgccgtctga

DBGET integrated database retrieval system