Palleronia sp. THAF1: FIU81_11475
Help
Entry
FIU81_11475 CDS
T06247
Symbol
uvrD
Name
(GenBank) DNA helicase II
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
maru
Palleronia sp. THAF1
Pathway
maru03420
Nucleotide excision repair
maru03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
maru00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
FIU81_11475 (uvrD)
03430 Mismatch repair
FIU81_11475 (uvrD)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
maru03400
]
FIU81_11475 (uvrD)
Enzymes [BR:
maru01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
FIU81_11475 (uvrD)
DNA repair and recombination proteins [BR:
maru03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
FIU81_11475 (uvrD)
MMR (mismatch excision repair)
Other MMR factors
FIU81_11475 (uvrD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
AAA_30
UvrD_C_2
PcrA_UvrD_tudor
AAA_11
Motif
Other DBs
NCBI-ProteinID:
QFU09295
LinkDB
All DBs
Position
complement(2270708..2273275)
Genome browser
AA seq
855 aa
AA seq
DB search
MLNPMYPEDESDAFDAAVPLSQRASAVHAAPYLEGLNPAQRAAVEALDGPVLMLAGAGTG
KTKALTARIAHLMMTGRARPNEILAVTFTNKAAREMKNRVGGLMGQTIEGMPWLGTFHAI
CVKLLRRHAELAGLKSNFTILDTDDQLRLLKQLIVAENIDEKRWPARQLAGLIDGWKNRA
LTPAKVPAADASAYNHRGTELYDFYQRRLLELNAVDFGDLLLHVVTIFQDHPDVLAQYQR
WFRFILVDEYQDTNVAQYLWLRLLAQDHKNICCVGDDDQSIYGWRGAEVGNILRFEKDFP
GAKVVRLEQNYRSTPHILAAASSVIDANEGRLGKTLWTAEETGEKVRLIGHWDGDEEARW
VGEEVEALNSGTSSVARRRNNPRSQTPAQEAERIAKGGKVSAGVMGDIHQVNLARAETLS
EAGRDNLPLPKSYGLDEIAILVRASHQMRAFEDRFLTIGLPYRVIGGPRFYERMEIRDAM
AYFRLAVSPDDDLAFERIVNTPKRGLGNIAQQKIQTTARANGVGLVDGARILLQDKGLGG
KGGAALRELVDGLARWADMVRDQGRSHIETAEIILDESGYTTFWQNDKTPEAPGRLENLK
ELVKALEGFENLQGFLEHVSLIMDNGSEQEGEKVSIMTLHAAKGLEFPAVFLPGWEDGLF
PSQRSMDESGKKGLEEERRLAYVGITRAEEVCTISFAANRRVYGQWQSALPSRFIDELPA
DHVDVLTPPGLYGGGYGAAGMAASASPQIMAQAESELHERVAKADVYNSPGWKRMQSRSQ
HRGMSQPKESRNMVIDAEAVSAFSTGDRVFHTKFGYGTVNGIEGDKLDVGFDKAGDKKVV
ARFLVDADSAGDTPF
NT seq
2568 nt
NT seq
+upstream
nt +downstream
nt
atgctgaaccccatgtatcctgaagacgaatccgatgcgttcgacgccgccgttcctctg
tcgcagcgggcgtccgccgtccatgccgcgccctatctggagggcctgaaccccgcgcag
cgcgcggcggtcgaggcgctggatgggccggtcctgatgctggcgggtgcgggcaccggc
aagaccaaggccctgacagcgcgcattgcgcacctgatgatgacgggccgcgcgcgcccg
aacgagattctggccgtgaccttcaccaacaaggccgcgcgcgagatgaagaaccgcgtc
ggtgggctgatgggccagacgatcgaggggatgccgtggctgggcacgttccacgcgatc
tgcgtcaagctgttgcggcggcatgcagagctggcggggctgaagtcgaacttcacgatt
ctggacaccgatgaccagttacgcctgctgaagcagttgatcgtggccgagaacatcgat
gaaaagcgctggcccgcgcggcagttggccggtctgatcgacggttggaagaaccgtgcg
ctgacgcctgcgaaggtgcccgccgccgatgcctcggcctacaatcatcgcggcaccgag
ctgtatgacttttatcaacgtcgcctgttggagctgaacgccgtcgatttcggcgatctt
ctgttgcacgtcgtcaccatcttccaggaccacccggacgtgctggcccagtaccaacgc
tggttccgtttcattctggtggacgagtatcaggatacgaacgtcgcccagtacctgtgg
cttcggctgctggcgcaagaccacaagaacatctgttgcgtgggcgacgatgaccaatcg
atctacggttggcgcggggccgaagtgggcaacatcctgcggttcgagaaggacttcccg
ggcgccaaggtcgttcggctggaacagaattaccgctcgacgccccatatcctggccgcc
gcatccagcgtgatcgacgcgaacgaggggcggctgggcaagacgctatggaccgctgag
gaaaccggcgagaaggtgcgcctgatcggccattgggatggcgacgaggaagcgcgctgg
gtcggtgaagaggtcgaggcacttaatagcggaacttcctcggtcgctcgacgccggaat
aatccacggtctcagacacctgctcaagaagctgagagaatagctaaaggcggcaaggtt
tctgcgggtgtgatgggagatattcatcaggtcaacttggcgcgcgctgaaacactgagc
gaagcaggccgggataatttgcctctgccgaagtcctatggtctggatgaaattgcaatt
cttgtccgcgcgtcgcaccagatgcgcgcgttcgaggatcggttcctgaccatcggcctg
ccgtatcgcgtcatcggcggcccccgcttttacgagcggatggagatccgtgatgccatg
gcctacttccgcctcgctgtatcgcccgacgatgatttggcgttcgagcggatcgtgaac
acgcccaagcgcggccttggcaatattgcgcaacagaagatccagacgacggcgcgcgcc
aatggcgtgggccttgtggatggcgcgcgcattctgctgcaagataaaggcttgggcggc
aagggcggcgcggcattacgggaattggtcgacgggctggcgcgctgggccgacatggtg
cgggatcaggggcgcagccatatcgagacggcggaaatcatcctagacgagtcgggctac
acgaccttctggcagaacgacaagacgcccgaagcgccgggtcggctggagaacctgaag
gaactggtcaaggcgctggaggggttcgagaacctgcaagggttccttgaacacgtgtcg
ctgatcatggacaacgggtccgagcaggagggcgagaaggtgtcgatcatgacgcttcac
gctgccaagggtctggagtttcccgccgtgttcctgccgggatgggaagacggcttgttt
ccgtcgcagcggtccatggacgagtcgggcaagaagggtttggaagaagagcgtcgtctt
gcctacgtcggtatcacccgcgccgaagaggtttgcacgatttccttcgctgccaaccgt
cgtgtgtatggccaatggcaatcggcgctgccgtcgcgctttattgatgaattgcccgcc
gatcacgtggacgttctgacgcctccgggcctgtatggtggcggttacggcgcggcgggt
atggcggccagcgcatcgccgcagatcatggcgcaggcggaatcggaactgcacgagcgc
gtggcgaaagcggatgtctataactcgcccggctggaagcggatgcagtcgcgcagccag
caccgtgggatgagccagccgaaagaaagccgcaacatggtgatcgacgccgaggcagtg
tcggcgttctccaccggcgatcgggtgttccacaccaagttcggctacggcaccgtcaac
gggatcgagggcgacaagctggacgtcggcttcgacaaggctggcgacaagaaggttgtc
gcgcgcttcttggtcgacgccgacagcgcaggcgacacaccgttctag
DBGET
integrated database retrieval system