Macrococcus armenti: LAU42_04735 Help Entry LAU42_04735       CDS       T07974                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mary  Macrococcus armenti Pathway mary00998   Biosynthesis of various antibiotics mary01100   Metabolic pathways mary01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mary00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LAU42_04735    00074 Mycolic acid biosynthesis     LAU42_04735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LAU42_04735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 PP-binding_2 Motif Other DBs NCBI-ProteinID:  UBH23251 LinkDB All DBs Position 909443..909676 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTADASFKDDLGADSLDIAELVMELEDQFGTEIPDEDAE KINTVGDAVKYIESLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaaaacttcgacaaagtaaaagatattatcgtagatcgtctaggtgttgatgcagac aaagttactgctgatgcttcatttaaagatgatttaggtgcagattcattagatatcgct gagctagtgatggaacttgaagatcaatttggaactgaaattccggatgaagatgctgaa aagatcaacactgtaggtgatgcagtgaaatacattgaatcattagaaaaataa

DBGET integrated database retrieval system