Myxocyprinus asiaticus (Chinese sucker): 127413002 Help Entry 127413002         CDS       T08782                                  Name (RefSeq) preproinsulin b isoform X1   KO K04526   insulin Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04068   FoxO signaling pathway masi04081   Hormone signaling masi04114   Oocyte meiosis masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127413002    04068 FoxO signaling pathway     127413002    04150 mTOR signaling pathway     127413002   09133 Signaling molecules and interaction    04081 Hormone signaling     127413002  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127413002   09143 Cell growth and death    04114 Oocyte meiosis     127413002   09142 Cell motility    04810 Regulation of actin cytoskeleton     127413002  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127413002    04914 Progesterone-mediated oocyte maturation     127413002  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:masi04052]     127413002 Cytokines and neuropeptides [BR:masi04052]  Neuropeptides   Unclassified    127413002 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Pex2_Pex12 Motif Other DBs NCBI-GeneID:  127413002 NCBI-ProteinID:  XP_051505734 LinkDB All DBs Position 22:complement(16048342..16062328) Genome browser AA seq 122 aa AA seqDB search MCNTAFWKICELLPIMVLLLQAAAIILLLAFLPGSVATPSQHLCGSNLVDALYLICGPKG FFYSNRNKRDLEALLFLLSNLADYEVVEADPLKEKVMKMKRGIVEQCCHRPCTVYHLEDY CS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtgcaacacagccttttggaagatttgtgagcttctgcccatcatggtcctgttgcta caggcagcagcaataatcctgctgctagctttcctgcctggatcagtcgctaccccatca cagcacctctgtggctctaacctggtggatgcgctttacctaatctgtgggcctaagggc ttcttttactccaacagaaacaagagggacctggaggctttgttgtttttgctctcaaat ctagcggattatgaggtagtggaagctgatccattaaaagagaaggtgatgaagatgaag agagggatagtggaacagtgctgtcacaggccctgcaccgtgtatcacctggaggactac tgtagctga

DBGET integrated database retrieval system