Myxocyprinus asiaticus (Chinese sucker): 127414841 Help Entry 127414841         CDS       T08782                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04144   Endocytosis masi04145   Phagosome masi04148   Efferocytosis masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127414841    04145 Phagosome     127414841    04140 Autophagy - animal     127414841    04137 Mitophagy - animal     127414841    04148 Efferocytosis     127414841  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127414841  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127414841   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127414841    04031 GTP-binding proteins [BR:masi04031]     127414841 Membrane trafficking [BR:masi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     127414841 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127414841   Exosomal proteins of other body fluids (saliva and urine)    127414841   Exosomal proteins of colorectal cancer cells    127414841   Exosomal proteins of bladder cancer cells    127414841 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     127414841 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 Septin PduV-EutP AAA_16 AAA_7 AAA_22 NTPase_1 G-alpha DUF5992 ATPase_2 AAA_24 ABC_tran SRPRB NB-ARC AAA_5 ATP-synt_ab NACHT AAA_14 DAP3 Motif Other DBs NCBI-GeneID:  127414841 NCBI-ProteinID:  XP_051509141 LinkDB All DBs Position 24:complement(38376309..38393850) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLDNRQVTTKRAQAWCQSKNNIPYYETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPASTSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcggaagaaggtgctgctgaaagtgatcatcctaggggattcaggagttggg aagacttctttgatgaaccagtatgtgaataataagtttagtaatcagtataaggccact attggagctgacttcctcaccaaggaggtgatggtggacgacagactggtcactatgcag atttgggacacagctggtcaagagcgatttcagtctctgggtgtggctttctacagaggg gcggactgttgcgtgttggtctatgacgtcacagcaccaactacgtttaagactctggac agctggagggatgagtttctcattcaggccagtccacgtgacccagagaacttccctttt gttgtgctaggcaacaaaattgacttggacaaccgacaggttacaacaaagcgagctcaa gcgtggtgtcagagtaagaacaatatcccctattatgagaccagtgccaaagaggccatt aacgtggaccaggctttccaaactattgctcgcaatgcactaaaacaggagtccgaagtg gagacatatgattttcctgaccagattaaactaagagatgacagacctgcatccactagt gatggctgcagctgctga

DBGET integrated database retrieval system