Myxocyprinus asiaticus (Chinese sucker): 127415059 Help Entry 127415059         CDS       T08782                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04012   ErbB signaling pathway masi04068   FoxO signaling pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04210   Apoptosis masi04218   Cellular senescence masi04370   VEGF signaling pathway masi04371   Apelin signaling pathway masi04540   Gap junction masi04625   C-type lectin receptor signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04912   GnRH signaling pathway masi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127415059    04012 ErbB signaling pathway     127415059    04370 VEGF signaling pathway     127415059    04371 Apelin signaling pathway     127415059    04068 FoxO signaling pathway     127415059    04150 mTOR signaling pathway     127415059  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127415059    04137 Mitophagy - animal     127415059   09143 Cell growth and death    04210 Apoptosis     127415059    04218 Cellular senescence     127415059   09144 Cellular community - eukaryotes    04540 Gap junction     127415059   09142 Cell motility    04810 Regulation of actin cytoskeleton     127415059  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127415059   09152 Endocrine system    04910 Insulin signaling pathway     127415059    04912 GnRH signaling pathway     127415059    04916 Melanogenesis     127415059  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127415059   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127415059    04031 GTP-binding proteins [BR:masi04031]     127415059 Membrane trafficking [BR:masi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127415059  Endocytosis   Macropinocytosis    Ras GTPases     127415059 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127415059   Exosomal proteins of other body fluids (saliva and urine)    127415059   Exosomal proteins of breast cancer cells    127415059   Exosomal proteins of colorectal cancer cells    127415059 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127415059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  127415059 NCBI-ProteinID:  XP_051509508 LinkDB All DBs Position 24:complement(8530532..8545064) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttggttgttgtgggagcaggtggtgttgggaagagcgctttgacc attcagctcattcagaatcactttgtggatgaatatgaccccactattgaggactcttac aggaagcaggtggtcattgatggtgagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagtgcaatgagggaccagtacatgaggacaggagagggcttcctctgc gtcttcgccataaacaacagcaaatcctttgccgatgtgcatttgtacagagagcagatc aagcgagtgaaggattccgatgacgtccccatggtcctagttgggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgcccgaagctatggtatagagttt gtagaaacgtctgccaagaccagacagggagttgaggatgctttctacacccttgttcgt gagattcggcattatcgcatgaaaaaacttaacagcagagaggacaggaaacagggctgc ctaggcgtctcttgtgaagtcatgtga

DBGET integrated database retrieval system