Myxocyprinus asiaticus (Chinese sucker): 127421845 Help Entry 127421845         CDS       T08782                                  Name (RefSeq) GTP-binding protein Rheb-like   KO K07208   Ras homolog enriched in brain Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04218   Cellular senescence masi04910   Insulin signaling pathway masi05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     127421845  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127421845   09143 Cell growth and death    04218 Cellular senescence     127421845  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     127421845  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     127421845  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:masi04031]     127421845 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Rheb     127421845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU YebF DUF1842 Motif Other DBs NCBI-GeneID:  127421845 NCBI-ProteinID:  XP_051520977 LinkDB All DBs Position 31:complement(44985354..44986118) Genome browser AA seq 134 aa AA seqDB search MPQPKSRKIDVLGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKRVPIMLVGNKKDLHMECVISCEEGKALAE SWNAAFMESSVKEN NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaaatcgcgaaagatcgacgtcctgggctacagatctgtcgggaaatcc tccttgacgatacagtttgtggaaggccagtttgttgactcatacgatccaactattgaa aacacgtttactaaaatgatcacagtgaacggtcaggagtatcacctgcagctagtggac acagcaggacaggatgaatactcaatttttccacagacgtactccatagatatcaacggt tacattttggtctattcagtcacgtcaaataaaagagtacccataatgctggtgggcaat aagaaagacctccacatggaatgtgtcatcagttgtgaagagggtaaagcgttggcagaa tcgtggaatgcagcgttcatggagtcctcagtgaaagagaactag

DBGET integrated database retrieval system