Myxocyprinus asiaticus (Chinese sucker): 127422356 Help Entry 127422356         CDS       T08782                                  Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04814   Motor proteins masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     127422356  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127422356  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:masi03037]     127422356    04812 Cytoskeleton proteins [BR:masi04812]     127422356 Cilium and associated proteins [BR:masi03037]  Motile cilia and associated proteins   Dynein arm    127422356 Cytoskeleton proteins [BR:masi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127422356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  127422356 NCBI-ProteinID:  XP_051521774 LinkDB All DBs Position 31:complement(18407154..18411510) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaggctgtgatcaagaatgctgacatgtctgaggacatgcagcaggat gcagtggactgtgccacacaggctatggagaaatacaatatcgagaaggatattgccgca tacatcaaaaaggagttcgataagaaatacaatcctacgtggcactgcattgtgggaagg aattttggcagctacgtgactcatgagacgaaacacttcatctacttctacttggggcag gtggccattctcctgttcaagtctggctga

DBGET integrated database retrieval system