Myxocyprinus asiaticus (Chinese sucker): 127423940 Help Entry 127423940         CDS       T08782                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04010   MAPK signaling pathway masi04012   ErbB signaling pathway masi04068   FoxO signaling pathway masi04137   Mitophagy - animal masi04140   Autophagy - animal masi04150   mTOR signaling pathway masi04210   Apoptosis masi04218   Cellular senescence masi04370   VEGF signaling pathway masi04371   Apelin signaling pathway masi04540   Gap junction masi04625   C-type lectin receptor signaling pathway masi04810   Regulation of actin cytoskeleton masi04910   Insulin signaling pathway masi04912   GnRH signaling pathway masi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:masi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127423940    04012 ErbB signaling pathway     127423940    04370 VEGF signaling pathway     127423940    04371 Apelin signaling pathway     127423940    04068 FoxO signaling pathway     127423940    04150 mTOR signaling pathway     127423940  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127423940    04137 Mitophagy - animal     127423940   09143 Cell growth and death    04210 Apoptosis     127423940    04218 Cellular senescence     127423940   09144 Cellular community - eukaryotes    04540 Gap junction     127423940   09142 Cell motility    04810 Regulation of actin cytoskeleton     127423940  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127423940   09152 Endocrine system    04910 Insulin signaling pathway     127423940    04912 GnRH signaling pathway     127423940    04916 Melanogenesis     127423940  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:masi04131]     127423940   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127423940    04031 GTP-binding proteins [BR:masi04031]     127423940 Membrane trafficking [BR:masi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127423940  Endocytosis   Macropinocytosis    Ras GTPases     127423940 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127423940   Exosomal proteins of other body fluids (saliva and urine)    127423940   Exosomal proteins of breast cancer cells    127423940   Exosomal proteins of colorectal cancer cells    127423940 GTP-binding proteins [BR:masi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127423940 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  127423940 NCBI-ProteinID:  XP_051524612 LinkDB All DBs Position 33:37020607..37033076 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagttggttgttgtgggagcaggtggtgtagggaaaagcgctttgacc attcagctcattcagaatcactttgtagatgaatatgaccccactattgaggactcttac aggaagcaggtggtcattgatggtgagacatgtctgctggacatcctggacactgccggt caggaggagtacagtgcaatgagggaccagtacatgaggacaggagagggcttcctctgc gtcttcgccataaacaacagcaaatccttcgccgatgtgcatttgtacagagagcaaatc aagcgagtgaaggattctgatgacgtccccatggtcctagttgggaacaagtgtgatttg gctagaacggtggacaccaagcaagctcaggaacttgccagaagctatgggatagagttt gtagaaacatctgccaagaccagacagggagttgaggatgctttttacactcttgtacgt gagattcggcattaccgcatgaaaaagctgaacagcagagaggacaggaaacagggctgc ctgggcgtgtcttgtgaagtcatgtga

DBGET integrated database retrieval system