Myxocyprinus asiaticus (Chinese sucker): 127425648 Help Entry 127425648         CDS       T08782                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism masi  Myxocyprinus asiaticus (Chinese sucker) Pathway masi04382   Cornified envelope formation masi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:masi00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     127425648  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127425648  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:masi04147]     127425648 Exosome [BR:masi04147]  Exosomal proteins   Exosomal proteins of microglial cells    127425648 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 DEK_C Motif Other DBs NCBI-GeneID:  127425648 NCBI-ProteinID:  XP_051527803 LinkDB All DBs Position 34:complement(35540902..35546031) Genome browser AA seq 101 aa AA seqDB search MPSELEKAMESLIMVFHRYAGKEGSPGTLTRRELRTLMENELAGFLKSQKDPTTIDRIMR DLDANGDGEVNFEEFVSLVLGLSIACEECYRMKLKKTRSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgaactagagaaggccatggagtccctcatcatggtgttccaccggtatgct gggaaagaagggagccctggcaccctgacccgtcgagagctccgaactctgatggagaat gaactagctgggtttctcaagtctcagaaagacccaaccacaatagacagaattatgaga gatctggatgccaatggggatggagaggtgaactttgaggagtttgtgtctctcgtattg ggtctatccatcgcctgtgaggagtgctacaggatgaaattaaagaagacacgaagctgg aagtga

DBGET integrated database retrieval system